PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10020455m
Common NameEUTSA_v10020455mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MYB
Protein Properties Length: 548aa    MW: 60315.4 Da    PI: 6.0923
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10020455mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.35.5e-164390148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +l+++vk++G g+W+++ ++  + R++k+c++rw ++l
  Thhalv10020455m 43 KGPWTSSEDGILINYVKKHGEGNWNAVQKHTSLSRCGKSCRLRWANHL 90
                     79******************************************9986 PP

2Myb_DNA-binding51.32.8e-1696139146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++++eE++l+v+ ++++G++ W+  a++++ gRt++++k++w++
  Thhalv10020455m  96 KGAFSQEEEQLIVEMHAKMGNK-WAHMAEHLP-GRTDNEIKNYWNT 139
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016932.1E-2791547IPR016310Transcription factor, GAMYB
PROSITE profilePS5129415.4983890IPR017930Myb domain
SuperFamilySSF466891.76E-2942137IPR009057Homeodomain-like
SMARTSM007172.1E-134292IPR001005SANT/Myb domain
PfamPF002493.4E-144390IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-234497IPR009057Homeodomain-like
CDDcd001671.88E-104590No hitNo description
PROSITE profilePS5129425.69791145IPR017930Myb domain
SMARTSM007179.3E-1795143IPR001005SANT/Myb domain
PfamPF002494.1E-1596139IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-2598144IPR009057Homeodomain-like
CDDcd001673.44E-1298139No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009908Biological Processflower development
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 548 aa     Download sequence    Send to blast
MSYTTTTVES DDGMQSSIHN ESPAADSIGN DNRSRGKGKV LKKGPWTSSE DGILINYVKK  60
HGEGNWNAVQ KHTSLSRCGK SCRLRWANHL RPNLKKGAFS QEEEQLIVEM HAKMGNKWAH  120
MAEHLPGRTD NEIKNYWNTR IKRRQRAGLP LYPPEIHVED LQWSEEYTTS NIFGVDRRRN  180
QDFLQLGNSK ANALFDDLNI ATSLLPGASD LSDMFACNML GTGATTSRYE SYMPPILPSP  240
KRLLESGSRF PMCSSNIKHE FQSPEHFQNT AQQKNHKSCS ISPCEVDHPR NGNRHSSDMM  300
IPNSHTFTDG MLPTSKPIFG AVKLELPSFQ YSETSAFDLW KTTPPSPQSD LVDSVDAYIQ  360
SPPPLEIEES DCFSSCDTGL LDMLLHEAKI KTSAKHRLLS SSSEKSFGSA TCTTDATLNV  420
PPGGETQIKS GEFEDSQKNL VTSEVSIPSQ LSTAFAGNVV KTEELDQVWE PKRVDITRPD  480
VLLASSWLDQ GCFGIVRDSS SMSDALALLL GGDDTGNSYV TVGSSSGQAP RGVGSCAWTN  540
MPPVWSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31411445107B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator of gibberellin-dependent alpha-amylase expression in aleurone cells. Involved in pollen and floral organs development. {ECO:0000256|PIRNR:PIRNR001693}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00348DAPTransfer from AT3G11440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195850.0AY519585.1 Arabidopsis thaliana MYB transcription factor (At3g11440) mRNA, complete cds.
GenBankBT0039400.0BT003940.1 Arabidopsis thaliana clone RAFL15-06-P04 (R20731) putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
GenBankBT0051200.0BT005120.1 Arabidopsis thaliana clone U20731 putative Myb DNA-binding protein (At3g11440) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006407447.10.0hypothetical protein EUTSA_v10020455mg
TrEMBLV4LEJ90.0V4LEJ9_EUTSA; Transcription factor
STRINGfgenesh2_kg.3__1182__AT3G11440.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38022859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11440.10.0myb domain protein 65